Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2), Unconjugated, E. coli

Artikelnummer: BIM-RPC28744
Artikelname: Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2), Unconjugated, E. coli
Artikelnummer: BIM-RPC28744
Hersteller Artikelnummer: RPC28744
Alternativnummer: BIM-RPC28744-20UG,BIM-RPC28744-100UG,BIM-RPC28744-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Polyphenol oxidase 2(PPO2, Phenolase 2, EC 1.14.18.1, Cresolase 2, Tyrosinase 2)
Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Agaricus bisporus (White button mushroom). Target Name: PPO2. Target Synonyms: Polyphenol oxidase 2(PPO2, Phenolase 2, EC 1.14.18.1, Cresolase 2, Tyrosinase 2). Accession Number: O42713. Expression Region: 1~378aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 51.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 51.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSLIATVGPTGGVKNRLNIVDFVKNEKFFTLYVRSLELLQAKEQHDYSSFFQLAGIHGLPFTEWAKERPSMNLYKAGYCTHGQVLFPTWHRTYLSVLEQILQGAAIEVAKKFTSNQTDWVQAAQDLRQPYWDWGFELMPPDEVIKNEEVNITNYDGKKISVKNPILRYHFHPIDPSFKPYGDFATWRTTVRNPDRNRREDIPGLIKKMRLEEGQIREKTYNMLKFNDAWERFSNHGISDDQHANSLESVHDDIHV
Target-Kategorie: PPO2