Recombinant Human Norrin (Ndp), Unconjugated, E. coli

Artikelnummer: BIM-RPC28750
Artikelname: Recombinant Human Norrin (Ndp), Unconjugated, E. coli
Artikelnummer: BIM-RPC28750
Hersteller Artikelnummer: RPC28750
Alternativnummer: BIM-RPC28750-20UG,BIM-RPC28750-100UG,BIM-RPC28750-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Norrin(Norrie disease protein, X-linked exudative vitreoretinopathy 2 protein)
Recombinant Human Norrin (Ndp) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Ndp. Target Synonyms: Norrin(Norrie disease protein, X-linked exudative vitreoretinopathy 2 protein). Accession Number: Q00604. Expression Region: 25~133aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 47.6kDa
Tag: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
Target-Kategorie: Ndp