Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC28752
Artikelname: Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC28752
Hersteller Artikelnummer: RPC28752
Alternativnummer: BIM-RPC28752-20UG,BIM-RPC28752-100UG,BIM-RPC28752-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Triggering receptor expressed on myeloid cells 2(TREM-2, Triggering receptor expressed on monocytes 2)
Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TREM2. Target Synonyms: Triggering receptor expressed on myeloid cells 2(TREM-2, Triggering receptor expressed on monocytes 2). Accession Number: Q9NZC2. Expression Region: 19~174aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 52.6kDa
Tag: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Target-Kategorie: TREM2