Recombinant Bothrops atrox Zinc metalloproteinase atroxlysin-1, Unconjugated, E. coli

Artikelnummer: BIM-RPC31187
Artikelname: Recombinant Bothrops atrox Zinc metalloproteinase atroxlysin-1, Unconjugated, E. coli
Artikelnummer: BIM-RPC31187
Hersteller Artikelnummer: RPC31187
Alternativnummer: BIM-RPC31187-20UG,BIM-RPC31187-100UG,BIM-RPC31187-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Reptile
Konjugation: Unconjugated
Alternative Synonym: SVMP, Atroxlysin-I
Recombinant Bothrops atrox Zinc metalloproteinase atroxlysin-1 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bothrops atrox (Barba amarilla) (Fer-de-lance). Target Name: Zinc metalloproteinase atroxlysin-1. Accession Number: P85420. Expression Region: 1-202aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 30.4kda. Target Synonyms: SVMP, Atroxlysin-I Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.4kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Reinheit: >85% by SDS-PAGE
Sequenz: TPEQQRYVDLFIVVDHGMFMKYNGNSDKIRRRIHQMVNIMKEAYSTMYIDILLTGVEIWSNKDLINVQPAAPQTLDSFGEWRKTDLLNRKSHDNAQLLTSTDFNGPTIGLAYVGSMCDPKRSTGVIQDHSEQDLMVAITMAHELGHNLGISHDTGSCSCGGYSCIMSPVLSHEPSKYFSDCSYIQCWDFIMKENPQCILNKR
Target-Kategorie: Zinc metalloproteinase atroxlysin-1