Recombinant Human V-set and immunoglobulin domain-containing protein 4 (VSIG4), partial , Active Protein, Unconjugated, Mammal

Artikelnummer: BIM-RPC31208
Artikelname: Recombinant Human V-set and immunoglobulin domain-containing protein 4 (VSIG4), partial , Active Protein, Unconjugated, Mammal
Artikelnummer: BIM-RPC31208
Hersteller Artikelnummer: RPC31208
Alternativnummer: BIM-RPC31208-20UG,BIM-RPC31208-100UG,BIM-RPC31208-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Protein Z39Ig
Recombinant Human V-set and immunoglobulin domain-containing protein 4 (VSIG4), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens). Target Name: V-set and immunoglobulin domain-containing protein 4 (VSIG4) . Accession Number: Q9Y279, VSIG4. Expression Region: 20-283aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 30.6kda. Target Synonyms: Protein Z39Ig Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.6kDa
Tag: C-Terminal 10xHis-Tagged
Reinheit: >95% by SDS-PAGE
Sequenz: RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGET
Target-Kategorie: V-set and immunoglobulin domain-containing protein 4 (VSIG4)