Recombinant Human 5 (3) -deoxyribonucleotidase, cytosolic type (NT5C), Unconjugated, E. coli

Artikelnummer: BIM-RPC31282
Artikelname: Recombinant Human 5 (3) -deoxyribonucleotidase, cytosolic type (NT5C), Unconjugated, E. coli
Artikelnummer: BIM-RPC31282
Hersteller Artikelnummer: RPC31282
Alternativnummer: BIM-RPC31282-20UG,BIM-RPC31282-100UG,BIM-RPC31282-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 3, Cytosolic 5,3-pyrimidine nucleotidase, Deoxy-5-nucleotidase 1, dNT-1
Recombinant Human 5 (3) -deoxyribonucleotidase, cytosolic type (NT5C) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: 5 (3) -deoxyribonucleotidase, cytosolic type (NT5C) . Accession Number: Q8TCD5, NT5C. Expression Region: 1-201aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 28.4kda. Target Synonyms: 3, Cytosolic 5,3-pyrimidine nucleotidase, Deoxy-5-nucleotidase 1, dNT-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.4kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
Target-Kategorie: 5 (3) -deoxyribonucleotidase, cytosolic type (NT5C)