Recombinant Human Piezo-type mechanosensitive ion channel component 1 (PIEZO1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC31287
Artikelname: Recombinant Human Piezo-type mechanosensitive ion channel component 1 (PIEZO1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC31287
Hersteller Artikelnummer: RPC31287
Alternativnummer: BIM-RPC31287-20UG,BIM-RPC31287-100UG,BIM-RPC31287-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Membrane protein induced by beta-amyloid treatment, Mib, Protein FAM38A
Recombinant Human Piezo-type mechanosensitive ion channel component 1 (PIEZO1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Piezo-type mechanosensitive ion channel component 1 (PIEZO1) . Accession Number: Q92508, PIEZO1. Expression Region: 2198-2431aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 33.6kda. Target Synonyms: Membrane protein induced by beta-amyloid treatment, Mib, Protein FAM38A Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.6kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS
Target-Kategorie: Piezo-type mechanosensitive ion channel component 1 (PIEZO1)