Human FBP1 protein

Artikelnummer: BYT-ORB10080
Artikelname: Human FBP1 protein
Artikelnummer: BYT-ORB10080
Hersteller Artikelnummer: orb10080
Alternativnummer: BYT-ORB10080-20,BYT-ORB10080-100,BYT-ORB10080-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: D-fructose-1,6-bisphosphate 1-phosphohydrolase 1 Liver FBPase
This Human FBP1 protein spans the amino acid sequence from region 2-338aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 56.7 kDa
UniProt: P09467
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-3398aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.