Zebrafish sod1 protein

Artikelnummer: BYT-ORB10292
Artikelname: Zebrafish sod1 protein
Artikelnummer: BYT-ORB10292
Hersteller Artikelnummer: orb10292
Alternativnummer: BYT-ORB10292-20,BYT-ORB10292-100,BYT-ORB10292-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: sod1, cuzn, Superoxide dismutase [Cu-Zn], EC 1.15.1.1
This Zebrafish sod1 protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 37.1 kDa
UniProt: O73872
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Danio rerio (Zebrafish) (Brachydanio rerio)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
Anwendungsbeschreibung: Biological Origin: Danio rerio (Zebrafish) (Brachydanio rerio). Application Notes: Tag info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-154aaSequence Info: Full Length Glycerol content: 0.5
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.