Recombinant Listeria monocytogenes serovar 1/2a Internalin-A (inlA) (S192N,Y369S), partial

Artikelnummer: BYT-ORB1095997
Artikelname: Recombinant Listeria monocytogenes serovar 1/2a Internalin-A (inlA) (S192N,Y369S), partial
Artikelnummer: BYT-ORB1095997
Hersteller Artikelnummer: orb1095997
Alternativnummer: BYT-ORB1095997-20,BYT-ORB1095997-100,BYT-ORB1095997-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Internalin A
This Recombinant Listeria monocytogenes serovar 1/2a Internalin-A (inlA) (S192N,Y369S), partial spans the amino acid sequence from region 32-414aa(S192N,Y369S). Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 48.9 kDa
UniProt: P0DJM0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NAQAATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLNFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQIS
Anwendungsbeschreibung: Biological Origin: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.