Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial

Artikelnummer: BYT-ORB1096059
Artikelname: Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial
Artikelnummer: BYT-ORB1096059
Hersteller Artikelnummer: orb1096059
Alternativnummer: BYT-ORB1096059-20,BYT-ORB1096059-100,BYT-ORB1096059-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Envelope glycoprotein(GP1,2)(GP) [Cleaved into, GP1, GP2, Shed GP(GP1,2-delta)]
This Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial spans the amino acid sequence from region 502-637aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 30.8 kDa
UniProt: Q7T9D9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Sudan ebolavirus (strain Uganda-00) (SEBOV) (Sudan Ebola virus)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN
Anwendungsbeschreibung: Biological Origin: Sudan ebolavirus (strain Uganda-00) (SEBOV) (Sudan Ebola virus). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.