Recombinant Human Melanoma-associated antigen B2 (MAGEB2)

Artikelnummer: BYT-ORB1096365
Artikelname: Recombinant Human Melanoma-associated antigen B2 (MAGEB2)
Artikelnummer: BYT-ORB1096365
Hersteller Artikelnummer: orb1096365
Alternativnummer: BYT-ORB1096365-20,BYT-ORB1096365-100,BYT-ORB1096365-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cancer/testis antigen 3.2 (CT3.2) (DSS-AHC critical interval MAGE superfamily 6) (DAM6) (MAGE XP-2 antigen)(MAGE-B2 antigen)
This Recombinant Human Melanoma-associated antigen B2 (MAGEB2) spans the amino acid sequence from region 1-319aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 39.2 kDa
UniProt: O15479
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.