Recombinant Dog Phospholipase A2 group XV (PLA2G15)

Artikelnummer: BYT-ORB1096383
Artikelname: Recombinant Dog Phospholipase A2 group XV (PLA2G15)
Artikelnummer: BYT-ORB1096383
Hersteller Artikelnummer: orb1096383
Alternativnummer: BYT-ORB1096383-20,BYT-ORB1096383-100,BYT-ORB1096383-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 1-O-acylceramide synthase (ACS) (LCAT-like lysophospholipase) (LLPL) (Lysophospholipase 3) (Lysosomal phospholipase A2) (LPLA2)
This Recombinant Dog Phospholipase A2 group XV (PLA2G15) spans the amino acid sequence from region 32-408aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 44.9 kDa
UniProt: Q6XPZ3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANY
Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.