Recombinant Human Transcription initiation factor TFIID subunit 7-like (TAF7L)

Artikelnummer: BYT-ORB1096404
Artikelname: Recombinant Human Transcription initiation factor TFIID subunit 7-like (TAF7L)
Artikelnummer: BYT-ORB1096404
Hersteller Artikelnummer: orb1096404
Alternativnummer: BYT-ORB1096404-20,BYT-ORB1096404-100,BYT-ORB1096404-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cancer/testis antigen 40 (CT40) (RNA polymerase II TBP-associated factor subunit Q) (TATA box-binding protein-associated factor 50 kDa) (Transcription initiation factor TFIID 50 kDa subunit)
This Recombinant Human Transcription initiation factor TFIID subunit 7-like (TAF7L) spans the amino acid sequence from region 1-302aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 42.2 kDa
UniProt: Q5H9L4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSVMEIQKQIEKKEKKLHKIQNKAQRQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.