Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85A (fbpA)

Artikelnummer: BYT-ORB1096447
Artikelname: Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85A (fbpA)
Artikelnummer: BYT-ORB1096447
Hersteller Artikelnummer: orb1096447
Alternativnummer: BYT-ORB1096447-20,BYT-ORB1096447-100,BYT-ORB1096447-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Acyl-CoA, diacylglycerol acyltransferase (Antigen 85 complex A) (85A) (Ag85A) (Fibronectin-binding protein A) (Fbps A)
This Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85A (fbpA) spans the amino acid sequence from region 43-338aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 35.8 kDa
UniProt: A1KQD8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVF
Anwendungsbeschreibung: Biological Origin: Mycobacterium bovis (strain BCG / Pasteur 1173P2). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.