Recombinant Enterovirus A71 Genome polyprotein, partial

Artikelnummer: BYT-ORB1096471
Artikelname: Recombinant Enterovirus A71 Genome polyprotein, partial
Artikelnummer: BYT-ORB1096471
Hersteller Artikelnummer: orb1096471
Alternativnummer: BYT-ORB1096471-1,BYT-ORB1096471-100,BYT-ORB1096471-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 3D polymerase (3Dpol) (Protein 3D) (3D)
This Recombinant Enterovirus A71 Genome polyprotein, partial spans the amino acid sequence from region 1441-1497aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 33.9 kDa
UniProt: F6KTB0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Enterovirus A71
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR
Anwendungsbeschreibung: Biological Origin: Enterovirus A71. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.