Recombinant Human Splicing factor 3B subunit 3 (SF3B3) (T899I), partial

Artikelnummer: BYT-ORB1096488
Artikelname: Recombinant Human Splicing factor 3B subunit 3 (SF3B3) (T899I), partial
Artikelnummer: BYT-ORB1096488
Hersteller Artikelnummer: orb1096488
Alternativnummer: BYT-ORB1096488-1,BYT-ORB1096488-100,BYT-ORB1096488-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pre-mRNA-splicing factor SF3b 130 kDa subunit (SF3b130) (STAF130) (Spliceosome-associated protein 130) (SAP 130)
This Recombinant Human Splicing factor 3B subunit 3 (SF3B3) (T899I), partial spans the amino acid sequence from region 819-1217aa(T899I). Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 52.1 kDa
UniProt: Q15393
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNIGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.