This Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M), partial spans the amino acid sequence from region 1-42aa. Purity: Greater than 90% as determined by SDS-PAGE.
Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle:
Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Reinheit:
Greater than 90% as determined by SDS-PAGE.
Formulierung:
Lyophilized powder
Sequenz:
MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG
Anwendungsbeschreibung:
Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
