Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial

Artikelnummer: BYT-ORB1096693
Artikelname: Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial
Artikelnummer: BYT-ORB1096693
Hersteller Artikelnummer: orb1096693
Alternativnummer: BYT-ORB1096693-1,BYT-ORB1096693-100,BYT-ORB1096693-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: S glycoprotein, E2, Peplomer protein
This Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial spans the amino acid sequence from region 16-685aa(N501Y,P681H). Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 104.4 kDa
UniProt: P0DTC2
Puffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL
Anwendungsbeschreibung: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.