Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial

Artikelnummer: BYT-ORB1096695
Artikelname: Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial
Artikelnummer: BYT-ORB1096695
Hersteller Artikelnummer: orb1096695
Alternativnummer: BYT-ORB1096695-1,BYT-ORB1096695-100,BYT-ORB1096695-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (S glycoprotein)(Peplomer protein)(Spike protein S1)(Spike protein S2)
This Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial spans the amino acid sequence from region 16-318aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 93.2 kDa
UniProt: P0DTC2
Puffer: Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL
Anwendungsbeschreibung: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.