ANGPT2 Protein

Artikelnummer: BYT-ORB1477839
Artikelname: ANGPT2 Protein
Artikelnummer: BYT-ORB1477839
Hersteller Artikelnummer: orb1477839
Alternativnummer: BYT-ORB1477839-1,BYT-ORB1477839-100,BYT-ORB1477839-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (ANG-2)
This ANGPT2 Protein spans the amino acid sequence from region 19-495aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 57.2 kDa
UniProt: A0A8J8
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVA
Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 µg/mL can bind anti-ANGPT2 recombinant antibody, the EC50 is 2.836-4.992 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 µg/ml can bind anti-ANGPT2 recombinant antibody, the EC50 is 2.836-4.992 ng/mL.