Recombinant Mycobacterium tuberculosis Protein Rv1269c (Rv1269c)

Artikelnummer: BYT-ORB1785254
Artikelname: Recombinant Mycobacterium tuberculosis Protein Rv1269c (Rv1269c)
Artikelnummer: BYT-ORB1785254
Hersteller Artikelnummer: orb1785254
Alternativnummer: BYT-ORB1785254-1,BYT-ORB1785254-100,BYT-ORB1785254-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Mycobacterium tuberculosis Protein Rv1269c (Rv1269c) spans the amino acid sequence from region 36-124aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 16.0 kDa
UniProt: P9WM45
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN
Anwendungsbeschreibung: Biological Origin: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.