Recombinant Acinetobacter baumannii Efflux pump membrane transporter (HMPREF0010_00594)

Artikelnummer: BYT-ORB1785290
Artikelname: Recombinant Acinetobacter baumannii Efflux pump membrane transporter (HMPREF0010_00594)
Artikelnummer: BYT-ORB1785290
Hersteller Artikelnummer: orb1785290
Alternativnummer: BYT-ORB1785290-100,BYT-ORB1785290-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Acinetobacter baumannii Efflux pump membrane transporter (HMPREF0010_00594) spans the amino acid sequence from region 1-1036aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 114.2 kDa
UniProt: D0C764
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MMSQFFIRRPVFAWVIAIFIIIFGLLSIPKLPIARFPSVAPPQVNISATYPGATAKTINDSVVTLIERELSGVKNLLYYSATTDTSGTAEITATFKPGTDVEMAQVDVQNKIKAVEARLPQVVRQQGLQVEASSSGFLMLVGINSPNNQYSEVDLSDYLVRNVVEELKRVEGVGKVQSFGAEKAMRIWVDPNKLVSYGLSISDVNNAIRENNVEIAPGRLGDLPAEKGQLITIPLSAQGQLSSLEQFKNISLKSK
Anwendungsbeschreibung: Biological Origin: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.