Recombinant Priestia megaterium Bifunctional cytochrome P450/NADPH--P450 reductase (cyp102A1), partial

Artikelnummer: BYT-ORB1785373
Artikelname: Recombinant Priestia megaterium Bifunctional cytochrome P450/NADPH--P450 reductase (cyp102A1), partial
Artikelnummer: BYT-ORB1785373
Hersteller Artikelnummer: orb1785373
Alternativnummer: BYT-ORB1785373-1,BYT-ORB1785373-100,BYT-ORB1785373-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (Cytochrome P450(BM-3)(Cytochrome P450BM-3)(Fatty acid monooxygenase)(Flavocytochrome P450 BM3)
This Recombinant Bacillus megaterium Bifunctional cytochrome P450/NADPH--P450 reductase (cyp102A1), partial spans the amino acid sequence from region 2-472aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 55.2 kDa
UniProt: P14779
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Priestia megaterium (strain ATCC 14581 / DSM 32 / CCUG 1817 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / NRRL B-14308 / VKM B-512 / Ford 19) (Bacillus megaterium)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIR
Anwendungsbeschreibung: Biological Origin: Priestia megaterium (strain ATCC 14581 / DSM 32 / CCUG 1817 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / NRRL B-14308 / VKM B-512 / Ford 19) (Bacillus megaterium). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.