Recombinant Pseudomonas putida RNA polymerase sigma factor RpoS (rpoS)

Artikelnummer: BYT-ORB1785437
Artikelname: Recombinant Pseudomonas putida RNA polymerase sigma factor RpoS (rpoS)
Artikelnummer: BYT-ORB1785437
Hersteller Artikelnummer: orb1785437
Alternativnummer: BYT-ORB1785437-1,BYT-ORB1785437-100,BYT-ORB1785437-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Pseudomonas putida RNA polymerase sigma factor RpoS (rpoS) spans the amino acid sequence from region 1-335aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.2 kDa
UniProt: Q88ME8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MALSKEVPEFDIDDDVLLMETGIVLETDVVSDEPAVSSVRTRAKSGSSLKQHKYIDYSRALDATQLYLNEIGFSPLLSPEEEVHFARLSQKGDPAGRKRMIESNLRLVVKIARRYVNRGLSLLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKELNVYLRAARELTQKLDHEPSPEEIATLLEKPVAEVKRMLGLNERVSSVDVSLGPDSDKTLLDTLTDDRPTDPCEL
Anwendungsbeschreibung: Biological Origin: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.