TRPM3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2133241
Artikelname: TRPM3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2133241
Hersteller Artikelnummer: orb2133241
Alternativnummer: BYT-ORB2133241-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence DISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQ
Konjugation: FITC
Alternative Synonym: GON-2, MLSN2, LTRPC3
TRPM3 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 198 kDa
NCBI: 996827
UniProt: Q9HCF6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQ