NUDT9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2133307
Artikelname: NUDT9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2133307
Hersteller Artikelnummer: orb2133307
Alternativnummer: BYT-ORB2133307-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUDT9
Konjugation: FITC
Alternative Synonym: NUDT10
NUDT9 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
UniProt: Q9BW91
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLV