GRIK2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2133342
Artikelname: GRIK2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2133342
Hersteller Artikelnummer: orb2133342
Alternativnummer: BYT-ORB2133342-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GRIK2
Konjugation: HRP
Alternative Synonym: EAA4, GLR6, MRT6, GLUK6, GLUR6, GluK2
GRIK2 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
UniProt: Q13002
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: YEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVI