GRIK2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2133343
| Artikelname: |
GRIK2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2133343 |
| Hersteller Artikelnummer: |
orb2133343 |
| Alternativnummer: |
BYT-ORB2133343-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GRIK2 |
| Konjugation: |
FITC |
| Alternative Synonym: |
EAA4, GLR6, MRT6, GLUK6, GLUR6, GluK2 |
| GRIK2 Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
64kDa |
| UniProt: |
Q13002 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: YEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVI |