P2RX2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2133357
Artikelname: P2RX2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2133357
Hersteller Artikelnummer: orb2133357
Alternativnummer: BYT-ORB2133357-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human P2RX2
Konjugation: HRP
Alternative Synonym: P2X2, DFNA41
P2RX2 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
UniProt: Q9UBL9
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: FIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKH