KCNRG Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2133370
Artikelname: KCNRG Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2133370
Hersteller Artikelnummer: orb2133370
Alternativnummer: BYT-ORB2133370-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNRG
Konjugation: FITC
Alternative Synonym: DLTET
KCNRG Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 955751
UniProt: Q0P6D0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFF