SP140 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2138539
Artikelname: SP140 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2138539
Hersteller Artikelnummer: orb2138539
Alternativnummer: BYT-ORB2138539-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SP140
Konjugation: HRP
Alternative Synonym: LYSP100, LYSP100-A, LYSP100-B
SP140 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 001005176
UniProt: Q13342
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNL