Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active)

Artikelnummer: BYT-ORB2280241
Artikelname: Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active)
Artikelnummer: BYT-ORB2280241
Hersteller Artikelnummer: orb2280241
Alternativnummer: BYT-ORB2280241-1,BYT-ORB2280241-100,BYT-ORB2280241-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: C-C CKR-5,CC-CKR-5,CCR-5,CCR5,CHEMR13,HIV-1 fusion coreceptor,CD antigen CD195
This Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active) spans the amino acid sequence from region 1-352aa. Purity: The purity information is not available for VLPs proteins.
Molekulargewicht: 42.3 kDa
UniProt: P51681
Puffer: Lyophilized powder
Quelle: Homo sapiens (Human)
Reinheit: The purity information is not available for VLPs proteins.
Formulierung: Lyophilized powder
Sequenz: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 µg/mL can bind Anti-CCR5 recombinant antibody. The EC50 is 1.099-1.287 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody. (This tag can be tested only under denaturing conditions.)
Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 µg/ml can bind Anti-CCR5 recombinant antibody. The EC50 is 1.099-1.287 ng/mL.The VLPs is negative control.