Rabbit Il17a protein

Artikelnummer: BYT-ORB244301
Artikelname: Rabbit Il17a protein
Artikelnummer: BYT-ORB244301
Hersteller Artikelnummer: orb244301
Alternativnummer: BYT-ORB244301-20,BYT-ORB244301-100,BYT-ORB244301-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Il17a Ctla8 Il17
This Rabbit Il17a protein spans the amino acid sequence from region 21-153aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 42.3 kDa
UniProt: G1SLF2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Oryctolagus cuniculus (Rabbit)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA
Anwendungsbeschreibung: Biological Origin: Oryctolagus cuniculus (Rabbit). Application Notes: Full length of GST-tag and expression region is 21-153aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.