Sheep IL1B protein

Artikelnummer: BYT-ORB244302
Artikelname: Sheep IL1B protein
Artikelnummer: BYT-ORB244302
Hersteller Artikelnummer: orb244302
Alternativnummer: BYT-ORB244302-20,BYT-ORB244302-100,BYT-ORB244302-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IL1B
This Sheep IL1B protein spans the amino acid sequence from region 114-266aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 21.7 kDa
UniProt: P21621
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Ovis aries (Sheep)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP
Anwendungsbeschreibung: Biological Origin: Ovis aries (Sheep). Application Notes: Full length of His-tag and expression region is 114-266aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.