Sheep IL6 protein

Artikelnummer: BYT-ORB244306
Artikelname: Sheep IL6 protein
Artikelnummer: BYT-ORB244306
Hersteller Artikelnummer: orb244306
Alternativnummer: BYT-ORB244306-20,BYT-ORB244306-100,BYT-ORB244306-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin BSF 2 protein, B cell differentiation factor protein, B cell stimulatory factor 2 protein, BSF 2 protein, BSF-2 protein, BSF2 protein, CDF protein, CTL differentiation factor protein, Cytotoxic T cell differentiation factor protein, HGF protein, HPGF protein, HSF protein, Hybridoma growth factor protein, Hybridoma plasmacytoma growth factor protein, IFNB2 protein, IL 6 protein, IL-6 protein, IL6 protein, IL6 protein protein, Interleukin 6 protein, Interleukin 6 protein, Interleukin BSF 2 protein, Interleukin-6 protein, Interleukin6 protein
This Sheep IL6 protein spans the amino acid sequence from region 30-208aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 47.5 kDa
UniProt: P29455
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Ovis aries (Sheep)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK
Anwendungsbeschreibung: Biological Origin: Ovis aries (Sheep). Application Notes: Full length of GST-tag and expression region is 30-208aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.