Dog IL8 protein

Artikelnummer: BYT-ORB244307
Artikelname: Dog IL8 protein
Artikelnummer: BYT-ORB244307
Hersteller Artikelnummer: orb244307
Alternativnummer: BYT-ORB244307-20,BYT-ORB244307-100,BYT-ORB244307-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 310C protein, 9E3 protein, AMCF1 protein, CEF-4 protein, chemokine, CXC motif, ligand 8 protein, CXC chemokine ligand 8 protein, CXC chemokine ligand 8 protein, CXCL 8 protein, Emoctakin protein, GCP 1 protein, GCP-1 protein, GCP1 protein, Granulocyte chemotactic protein 1 protein, IL 8 protein, IL8/NAP1 form I protein, Inteleukin 8 protein, Interleukin8 protein, K60 protein, LECT protein, LECT protein, LYNAP protein, MDNCF protein, Monocyte derived neutrophil activating peptide protein, NAF protein, NAP 1 protein, Neutrophil activating factor protein, Neutrophil activating factor protein, Neutrophil activating peptide 1 protein, SCYB8 protein, T-cell chemotactic factor protein, TSG1 protein
This Dog IL8 protein spans the amino acid sequence from region 23-101aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 36.1 kDa
UniProt: P41324
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: Full length of GST-tag and expression region is 23-101aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.