Dog IL8 protein
Artikelnummer:
BYT-ORB244307
- Bilder (1)
| Artikelname: | Dog IL8 protein |
| Artikelnummer: | BYT-ORB244307 |
| Hersteller Artikelnummer: | orb244307 |
| Alternativnummer: | BYT-ORB244307-20,BYT-ORB244307-100,BYT-ORB244307-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 310C protein, 9E3 protein, AMCF1 protein, CEF-4 protein, chemokine, CXC motif, ligand 8 protein, CXC chemokine ligand 8 protein, CXC chemokine ligand 8 protein, CXCL 8 protein, Emoctakin protein, GCP 1 protein, GCP-1 protein, GCP1 protein, Granulocyte chemotactic protein 1 protein, IL 8 protein, IL8/NAP1 form I protein, Inteleukin 8 protein, Interleukin8 protein, K60 protein, LECT protein, LECT protein, LYNAP protein, MDNCF protein, Monocyte derived neutrophil activating peptide protein, NAF protein, NAP 1 protein, Neutrophil activating factor protein, Neutrophil activating factor protein, Neutrophil activating peptide 1 protein, SCYB8 protein, T-cell chemotactic factor protein, TSG1 protein |
| This Dog IL8 protein spans the amino acid sequence from region 23-101aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 36.1 kDa |
| UniProt: | P41324 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Canis lupus familiaris (Dog) (Canis familiaris) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
| Anwendungsbeschreibung: | Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: Full length of GST-tag and expression region is 23-101aa |

