Mouse Lgals7 protein

Artikelnummer: BYT-ORB244342
Artikelname: Mouse Lgals7 protein
Artikelnummer: BYT-ORB244342
Hersteller Artikelnummer: orb244342
Alternativnummer: BYT-ORB244342-20,BYT-ORB244342-100,BYT-ORB244342-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Lgals7
This Mouse Lgals7 protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 19 kDa
UniProt: O54974
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-tag and expression region is 2-136aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.