Mouse Map2 protein

Artikelnummer: BYT-ORB244361
Artikelname: Mouse Map2 protein
Artikelnummer: BYT-ORB244361
Hersteller Artikelnummer: orb244361
Alternativnummer: BYT-ORB244361-20,BYT-ORB244361-100,BYT-ORB244361-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Map2
This Mouse Map2 protein spans the amino acid sequence from region 213-559aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 54 kDa
UniProt: P20357
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GMEGEKLPPVPFAQTFGTNLEDRKQSTEPSIVMPSIGLSAEPPAPKEPKDWFIEMPTESKKDEWGLAAPISPGPLTPMREKDVLEDIPRWEGKQFDSPMPSPFHGGSFTLPLDTMKNERVSEGPRPFAPVFFQSDDKVSLQDPSALATSKESSKDEEPLKDKADKVADVSISEVTTLLGNVHSPVVEGYVGENISGEVKVTTDQEKKETSAPSVQEPTLTETEPQTKLDEKSTVSIEEAVAKKEESFKLRDDKTG
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Partial of His-SUMO-tag and expression region is 213-559aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.