E.coli mdh protein

Artikelnummer: BYT-ORB244369
Artikelname: E.coli mdh protein
Artikelnummer: BYT-ORB244369
Hersteller Artikelnummer: orb244369
Alternativnummer: BYT-ORB244369-20,BYT-ORB244369-100,BYT-ORB244369-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: mdh, b3236, JW3205 Malate dehydrogenase
This E.coli mdh protein spans the amino acid sequence from region 2-312aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 37.5 kDa
UniProt: P49814
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bacillus subtilis (strain 168)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GNTRKKVSVIGAGFTGATTAFLIAQKELADVVLVDIPQLENPTKGKALDMLEASPVQGFDAKITGTSNYEDTAGSDIVVITAGIARKPGMSRDDLVSTNEKIMRSVTQEIVKYSPDSIIVVLTNPVDAMTYAVYKESGFPKERVIGQSGVLDTARFRTFVAEELNLSVKDVTGFVLGGHGDDMVPLVRYSYAGGIPLETLIPKERIDAIVERTRKGGGEIVNLLGNGSAYYAPAASLTEMVEAILKDQRRVLPTI
Anwendungsbeschreibung: Biological Origin: Bacillus subtilis (strain 168). Application Notes: Full length of His-tag and expression region is 2-312aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.