Human MFGE8 protein

Artikelnummer: BYT-ORB244373
Artikelname: Human MFGE8 protein
Artikelnummer: BYT-ORB244373
Hersteller Artikelnummer: orb244373
Alternativnummer: BYT-ORB244373-20,BYT-ORB244373-100,BYT-ORB244373-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: MFGE8
This Human MFGE8 protein spans the amino acid sequence from region 24-387aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 56.8 kDa
UniProt: Q08431
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAW
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 24-387aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.