Rat Mmp7 protein

Artikelnummer: BYT-ORB244379
Artikelname: Rat Mmp7 protein
Artikelnummer: BYT-ORB244379
Hersteller Artikelnummer: orb244379
Alternativnummer: BYT-ORB244379-20,BYT-ORB244379-100,BYT-ORB244379-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Mmp7
This Rat Mmp7 protein spans the amino acid sequence from region 98-267aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 45.9 kDa
UniProt: P50280
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of GST-tag and expression region is 98-267aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.