Human MRPL54 protein

Artikelnummer: BYT-ORB244386
Artikelname: Human MRPL54 protein
Artikelnummer: BYT-ORB244386
Hersteller Artikelnummer: orb244386
Alternativnummer: BYT-ORB244386-20,BYT-ORB244386-100,BYT-ORB244386-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: MRPL54
This Human MRPL54 protein spans the amino acid sequence from region 15-138aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 18.2 kDa
UniProt: Q6P161
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-tag and expression region is 15-138aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.