Human MRPL55 protein

Artikelnummer: BYT-ORB244387
Artikelname: Human MRPL55 protein
Artikelnummer: BYT-ORB244387
Hersteller Artikelnummer: orb244387
Alternativnummer: BYT-ORB244387-20,BYT-ORB244387-100,BYT-ORB244387-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: MRPL55
This Human MRPL55 protein spans the amino acid sequence from region 34-128aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.6 kDa
UniProt: Q7Z7F7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of GST-tag and expression region is 34-128aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.