Human Parkin protein

Artikelnummer: BYT-ORB244427
Artikelname: Human Parkin protein
Artikelnummer: BYT-ORB244427
Hersteller Artikelnummer: orb244427
Alternativnummer: BYT-ORB244427-20,BYT-ORB244427-100,BYT-ORB244427-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: E3 ubiquitin ligase protein, E3 ubiquitin protein ligase parkin protein, E3 ubiquitin-protein ligase parkin protein, LPRS 2 protein, LPRS2 protein, PARK 2 protein, PARK2 protein, Parkin 2 protein, Parkinson disease (autosomal recessive juvenile) 2 protein, Parkinson disease (autosomal recessive, juvenile) 2, parkin protein, Parkinson disease protein 2 protein, Parkinson juvenile disease protein 2 protein, Parkinson protein 2 E3 ubiquitin protein ligase protein, Parkinson protein 2, E3 ubiquitin protein ligase (parkin) protein, PRKN 2 protein, PRKN protein, PRKN2 protein
This Human Parkin protein spans the amino acid sequence from region 1-465aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 67.6 kDa
UniProt: O60260
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-465aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.