Mouse C1qa protein

Artikelnummer: BYT-ORB245767
Artikelname: Mouse C1qa protein
Artikelnummer: BYT-ORB245767
Hersteller Artikelnummer: orb245767
Alternativnummer: BYT-ORB245767-20,BYT-ORB245767-100,BYT-ORB245767-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: C1qa
This Mouse C1qa protein spans the amino acid sequence from region 23-245aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 25.6 kDa
UniProt: P98086
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel