Yeast rgpA protein

Artikelnummer: BYT-ORB246079
Artikelname: Yeast rgpA protein
Artikelnummer: BYT-ORB246079
Hersteller Artikelnummer: orb246079
Alternativnummer: BYT-ORB246079-20,BYT-ORB246079-100,BYT-ORB246079-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: rgpA
This Yeast rgpA protein spans the amino acid sequence from region 228-720aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 56 kDa
UniProt: P28784
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Porphyromonas gingivalis
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YTPVEEKQNGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPC
Anwendungsbeschreibung: Biological Origin: Porphyromonas gingivalis. Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Porphyromonas gingivalisrgpA.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Porphyromonas gingivalisrgpA.