Yeast T7 Helix-destabilizing protein
Artikelnummer:
BYT-ORB246128
- Bilder (3)
| Artikelname: | Yeast T7 Helix-destabilizing protein |
| Artikelnummer: | BYT-ORB246128 |
| Hersteller Artikelnummer: | orb246128 |
| Alternativnummer: | BYT-ORB246128-20,BYT-ORB246128-100,BYT-ORB246128-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 2.5 |
| This Yeast T7 Helix-destabilizing protein spans the amino acid sequence from region 1-232aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 25.7 kDa |
| UniProt: | P03696 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Escherichia phage T7 (Bacteriophage T7) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF |
| Anwendungsbeschreibung: | Biological Origin: Escherichia phage T7 (Bacteriophage T7). Application Notes: This is His-tag protein |



