Yeast hly protein

Artikelnummer: BYT-ORB246162
Artikelname: Yeast hly protein
Artikelnummer: BYT-ORB246162
Hersteller Artikelnummer: orb246162
Alternativnummer: BYT-ORB246162-20,BYT-ORB246162-100,BYT-ORB246162-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: hly
This Yeast hly protein spans the amino acid sequence from region 27-319aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 35.3 kDa
UniProt: Q2G1X0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Staphylococcus aureus (strain NCTC 8325)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDD
Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain NCTC 8325). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain NCTC 8325) hly.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain NCTC 8325) hly.