Bovine ADIPOQ protein

Artikelnummer: BYT-ORB246165
Artikelname: Bovine ADIPOQ protein
Artikelnummer: BYT-ORB246165
Hersteller Artikelnummer: orb246165
Alternativnummer: BYT-ORB246165-20,BYT-ORB246165-100,BYT-ORB246165-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ADIPOQ
This Bovine ADIPOQ protein spans the amino acid sequence from region 18-240aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.4 kDa
UniProt: Q3Y5Z3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bos taurus (Bovine)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
Anwendungsbeschreibung: Biological Origin: Bos taurus (Bovine). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Bos taurus (Bovine) ADIPOQ.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Bos taurus (Bovine) ADIPOQ.